PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3501s0057.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ZF-HD
Protein Properties Length: 321aa    MW: 36333.7 Da    PI: 7.5001
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3501s0057.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.82.3e-3292147359
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                           v+YkeClkNhAa++Gg+a+DGCgEfmps ge+g+++al+C+AC+CHRnFHR+eve 
  Cagra.3501s0057.1.p  92 MVKYKECLKNHAAAMGGNATDGCGEFMPS-GEDGSIEALTCSACNCHRNFHRKEVEG 147
                          699*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-3193156IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.9E-2993145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-3194145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.43695144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.66E-19215286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-29218287IPR009057Homeodomain-like
TIGRFAMsTIGR015657.3E-27225281IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MEIASQEDHD MPIPLNTTFG AAGGDGHGHM NIHHHHDLHA PNSAPPTHNN ITTQPPQMPL  60
HGNGHGNNYD HHHHHHQDPH HVSYNAIIKK PMVKYKECLK NHAAAMGGNA TDGCGEFMPS  120
GEDGSIEALT CSACNCHRNF HRKEVEGEPA ATAMSPYHQQ PPPRKLMLNH HKIRSAMPHQ  180
MIMPIGVSNY RYMHNNSESE DFMEEDGVGV TAASRSLPHM PYNQKKRFRT KFTPEQKEKM  240
LNFAEKVGWK IQRQEDCVVQ RFCEEIGVKR RVLKVWMHNN KIHFSKKNNI NLEDNDNNEK  300
SNNLNNVDLS ANNDITKIVP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-232262811873ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742660.0AY074266.1 Arabidopsis thaliana unknown protein (At1g14440) mRNA, complete cds.
GenBankAY0967380.0AY096738.1 Arabidopsis thaliana unknown protein (At1g14440) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF14L170.0AC012188.2 Sequence of BAC F14L17 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305389.10.0hypothetical protein CARUB_v10009782mg
RefseqXP_006305390.10.0hypothetical protein CARUB_v10009782mg
SwissprotQ9M9S00.0ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLR0IMH20.0R0IMH2_9BRAS; Uncharacterized protein
STRINGscaffold_101615.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33392665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-163homeobox protein 31